Pfam domain
Pfam family: Ribosomal_L20 (PF00453.17)
Uniprot AC: Q2TBR2
RecName: 39S ribosomal protein L20, mitochondrial
Begin-End: 11-116
Organism: Bos taurus
Interaction Mode:   

Sequence:
RNRITDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVRCTRARSLKKRHLRTLWIN
RITAASQEHGLKYPAFILNLIKCQVELNRKVLADLAIYEPKTFKSL
Structures of the domain Q2TBR2 11-116
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 L 15-116 None


© NPIDB team 2003 - 2019

text