Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: Q2YDI0
RecName: 39S ribosomal protein L11, mitochondrial
Begin-End: 13-78
Organism: Bos taurus
Interaction Mode:   

Sequence:
KPEAEGVIRTILRAGQAMPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFV
KPDRTF
Structures of the domain Q2YDI0 13-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 G 20-78 None
3iy9 X-ray 14.1 G 8-66 None


© NPIDB team 2003 - 2019

text