Pfam domain
Pfam family: TFIIS_C (PF01096.17)
Uniprot AC: Q32P73
RecName: DNA-directed RNA polymerase II subunit RPB9
Begin-End: 84-124
Organism: Bos taurus
Interaction Mode:   

Sequence:
HPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWT
Structures of the domain Q32P73 84-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 I 84-124 None
5flm X-ray 3.4 I 84-124 None


© NPIDB team 2003 - 2019

text