Pfam domain
Pfam family: RNA_pol_L_2 (PF13656.5)
Uniprot AC: Q32P79
RecName: DNA-directed RNA polymerase II subunit RPB11
Begin-End: 30-104
Organism: Bos taurus
Interaction Mode:   

Sequence:
ACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTN
AITDLISELSLLEER
Structures of the domain Q32P79 30-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 K 31-103 None
5flm X-ray 3.4 K 31-103 None


© NPIDB team 2003 - 2019

text