Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: Q32PC3
RecName: 39S ribosomal protein L27, mitochondrial
Begin-End: 31-99
Organism: Bos taurus
Interaction Mode:   

Sequence:
ASKKTGGSSKNLGGKSPGKRFGIRKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLY
ALEEGVVRY
Structures of the domain Q32PC3 31-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 O 31-99 None


© NPIDB team 2003 - 2019

text