Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.21)
Uniprot AC: Q32PE0
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC2
Begin-End: 51-104
Organism: Bos taurus
Interaction Mode:   

Sequence:
RITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPI
Structures of the domain Q32PE0 51-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 F 51-104 None
5flm X-ray 3.4 F 51-104 None


© NPIDB team 2003 - 2019

text