Pfam domain
Pfam family: HTH_19 (PF12844.9)
Uniprot AC: Q32WH4
RecName: Csp231I C protein
Begin-End: 3-70
Organism: Citrobacter sp. RFL231
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
IRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIPVS
YLYTPEDD
Structures of the domain Q32WH4 3-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jcx X-ray 2.3 A 3-70  H-Bb H-Mj L-Bb L-Mj 
4jcx X-ray 2.3 B 3-70  H-Bb H-Mj L-Bb L-Mj 
4jqd X-ray 2.75 A 3-70  H-Bb H-Mj L-Bb L-Mj 
4jqd X-ray 2.75 B 3-70  H-Bb H-Mj L-Bb L-Mj 
4jqd X-ray 2.75 E 3-70  H-Bb H-Mj L-Bb L-Mj 
4jqd X-ray 2.75 F 3-70  H-Bb H-Mj L-Bb L-Mj 
4jcy X-ray 1.8 B 3-70  H-Bb H-Mj L-Bb L-Mj 
4jcy X-ray 1.8 A 3-70  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text