Pfam domain
Pfam family: DNA_pol_B (PF00136.20)
Uniprot AC: Q38087
RecName: DNA-directed DNA polymerase
Begin-End: 363-779
Organism: Enterobacteria phage RB69
Interaction Mode:   

Sequence:
KTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPIPNRYKYVMSFDLTSLYPSIIRQ
VNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFNQR
KEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEML
FRAQRTEVAGMTAQINRKLLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVN
EYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESKFRDTNHWVDFLDKFARERMEPA
IDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRYAE
PKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISI
Structures of the domain Q38087 363-779
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2oyq X-ray 2.86 B 368-771 None
2p5o X-ray 2.8 B 368-629 None
2p5o X-ray 2.8 D 368-629 None
2p5g X-ray 2.8 B 368-629 None


© NPIDB team 2003 - 2019

text