Pfam domain
Pfam family: DNA_pol_B (PF00136.20)
Uniprot AC: Q38087
RecName: DNA-directed DNA polymerase
Begin-End: 363-784
Organism: Enterobacteria phage RB69
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mn 

Sequence:
KTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPIPNRYKYVMSFDLTSLYPSIIRQ
VNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFNQR
KEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEML
FRAQRTEVAGMTAQINRKLLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVN
EYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESKFRDTNHWVDFLDKFARERMEPA
IDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRYAE
PKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASV
SS
Structures of the domain Q38087 363-784
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3cfr X-ray 2.4 A 368-770  L-Bb L-Mn 
3s9h X-ray 1.95 A 368-770  L-Bb L-Mn 
3rwu X-ray 2.33 A 368-770  L-Bb L-Mn 
4dtu X-ray 1.86 A 368-770  L-Bb L-Mn 
3sup X-ray 2.32 A 368-770  S-Bb L-Bb L-Mn 
1q9x X-ray 2.69 D 368-770  L-Bb L-Mn 
1q9x X-ray 2.69 C 368-770 None
1q9x X-ray 2.69 B 368-770 None
1q9x X-ray 2.69 A 368-770 None
3cfp X-ray 2.5 A 368-770  L-Bb L-Mn 
1q9y X-ray 2.8 A 371-773  L-Bb L-Mn 
3nci X-ray 1.79 A 368-770  L-Bb L-Mn 
4j2e X-ray 2.02 A 368-770  S-Bb L-Bb L-Mn 
4m42 X-ray 2.04 A 368-770 None
1clq X-ray 2.7 A 368-770 None
3qer X-ray 1.96 A 368-770  L-Bb L-Mn 
4fj8 X-ray 2.19 A 368-770 None
3uiq X-ray 1.88 A 368-770  S-Bb L-Bb L-Mn 
1ig9 X-ray 2.6 A 368-770  L-Bb L-Mn 
3lzi X-ray 2.3 A 368-770  L-Bb L-Mn 
4j2b X-ray 2.04 A 368-770  S-Bb L-Bb L-Mn 
3l8b X-ray 2.15 A 368-770  S-Bb L-Bb L-Mn 
3l8b X-ray 2.15 B 368-770  S-Bb L-Bb L-Mn 
4dts X-ray 1.96 A 368-770  L-Bb L-Mn 
3nae X-ray 2 A 368-770  L-Bb L-Mn 
3ne6 X-ray 2 A 368-770  L-Bb L-Mn 
3nhg X-ray 2.5 A 368-770  L-Bb L-Mn 
3ndk X-ray 2 A 368-770  L-Bb L-Mn 
3ngi X-ray 1.89 A 368-770  L-Bb L-Mn 
3cq8 X-ray 2.5 A 368-770  S-Bb L-Bb L-Mn 
3lzj X-ray 2.05 A 368-770  L-Bb L-Mn 
3suo X-ray 2.23 A 368-770  S-Bb L-Bb L-Mn 
3spy X-ray 2.14 A 368-770  S-Bb L-Bb L-Mn 
3qep X-ray 1.8 A 368-770  L-Bb L-Mn 
3sjj X-ray 2.38 A 368-770  S-Bb L-Bb L-Mn 
3snn X-ray 2 A 368-770  L-Bb L-Mn 
2oyq X-ray 2.86 A 368-770  L-Bb L-Mn 
2oyq X-ray 2.86 C 368-770  S-Bb L-Bb L-Mn 
2oyq X-ray 2.86 D 368-770 None
3sq0 X-ray 2 A 368-770  L-Bb L-Mn 
3scx X-ray 2.35 A 368-770  S-Bb L-Bb L-Mn 
3spz X-ray 2.43 A 368-770  S-Bb L-Bb L-Mn 
3si6 X-ray 1.85 A 368-770  S-Bb L-Bb L-Mn 
3sq1 X-ray 1.82 A 368-770  L-Bb L-Mn 
3sq4 X-ray 2.23 A 368-770  S-Bb L-Bb L-Mn 
3tag X-ray 2.95 C 368-770  L-Bb L-Mn 
3tag X-ray 2.95 B 368-770 None
3tag X-ray 2.95 A 368-770 None
3tag X-ray 2.95 D 368-770 None
3suq X-ray 3.15 A 368-770  L-Bb L-Mn 
3sq2 X-ray 2.1 A 368-770  L-Bb L-Mn 
3sun X-ray 2.42 A 368-770  L-Bb L-Mn 
3tae X-ray 2.71 B 368-770  S-Bb L-Bb L-Mn 
3tae X-ray 2.71 C 368-770  H-Mn S-Bb L-Bb L-Mn 
3tae X-ray 2.71 A 368-770  L-Bb L-Mn 
3tae X-ray 2.71 D 368-770 None
3tab X-ray 2.8 C 368-770  S-Bb L-Bb L-Mn 
3tab X-ray 2.8 B 368-770  L-Bb L-Mn 
3tab X-ray 2.8 A 368-770  L-Bb L-Mn 
3tab X-ray 2.8 D 368-770  L-Bb L-Mn 
3taf X-ray 3 C 368-770  S-Bb L-Bb L-Mn 
3taf X-ray 3 B 368-770  L-Bb 
3taf X-ray 3 A 368-770  L-Bb L-Mn 
3taf X-ray 3 D 368-770  S-Bb L-Bb 
3qet X-ray 2.08 A 368-770  L-Bb L-Mn 
3qev X-ray 1.77 A 368-770  L-Bb L-Mn 
3qew X-ray 1.84 A 368-770  L-Bb L-Mn 
3qes X-ray 1.98 A 368-770  L-Bb L-Mn 
3qex X-ray 1.73 A 368-770  L-Bb L-Mn 
4fk0 X-ray 2.18 A 368-770  S-Bb L-Bb L-Mn 
4dtn X-ray 1.96 A 368-770  S-Bb L-Bb L-Mn 
3qei X-ray 2.18 A 368-770  L-Bb L-Mn 
3qnn X-ray 1.92 A 368-770  L-Bb L-Mn 
4m3x X-ray 2.2 A 368-770 None
4du1 X-ray 2.15 A 368-770  L-Bb L-Mn 
4dtp X-ray 2.05 A 368-770  S-Bb L-Bb L-Mn 
4dtr X-ray 2.04 A 368-770  L-Bb L-Mn 
4du4 X-ray 2.28 A 368-770  L-Bb 
4e3s X-ray 2.04 A 368-770  L-Bb L-Mn 
4du3 X-ray 2.02 A 368-770  L-Bb L-Mn 
4dtm X-ray 1.95 A 368-770  S-Bb L-Bb L-Mn 
4dto X-ray 2.05 A 368-770  S-Bb L-Bb L-Mn 
4dtj X-ray 1.9 A 368-770  S-Bb L-Bb L-Mn 
4dtx X-ray 1.84 A 368-770  L-Bb L-Mn 
3qno X-ray 1.88 A 368-770  L-Bb L-Mn 
4fji X-ray 2.2 A 368-770  S-Bb L-Bb L-Mn 
4fj5 X-ray 2.05 A 368-770  S-Bb L-Bb L-Mn 
4fjj X-ray 1.99 A 368-770  S-Bb L-Bb L-Mn 
4fjk X-ray 2 A 368-770  S-Bb L-Bb L-Mn 
4fjm X-ray 2.02 A 368-770  S-Bb L-Bb L-Mn 
4fjn X-ray 1.98 A 368-770  L-Bb L-Mn 
4fjh X-ray 2.11 A 368-770  S-Bb L-Bb L-Mn 
4fk4 X-ray 1.9 A 368-770  L-Bb L-Mn 
4fjl X-ray 1.87 A 368-770  S-Bb L-Bb L-Mn 
4fj7 X-ray 1.9 A 368-770  S-Bb L-Bb L-Mn 
4fjx X-ray 2.11 A 368-770  S-Bb L-Bb L-Mn 
4fjg X-ray 2.02 A 368-770  S-Bb L-Bb L-Mn 
4khn X-ray 2.55 B 368-770  S-Bb L-Bb L-Mn 
4khn X-ray 2.55 A 368-770 None
4fj9 X-ray 1.97 A 368-770  S-Bb L-Bb L-Mn 
4m3r X-ray 2.07 A 368-770  L-Bb L-Mn 
4j2a X-ray 1.8 A 368-770  S-Bb L-Bb L-Mn 
4khu X-ray 2.05 A 368-770  H-Bb S-Bb L-Bb L-Mn 
4i9q X-ray 2.3 B 368-770  S-Bb L-Bb L-Mn 
4i9q X-ray 2.3 A 368-769 None
4ki4 X-ray 2.45 A 367-769  H-Bb S-Bb L-Bb L-Mn 
4khs X-ray 2.12 A 367-769  S-Bb L-Bb L-Mn 
4fk2 X-ray 1.98 A 368-770  S-Bb L-Bb L-Mn 
4khy X-ray 2.25 A 368-770  S-Bb L-Bb 
4khq X-ray 2.19 A 368-770  H-Bb S-Bb L-Bb L-Mn 
4khw X-ray 2.37 A 368-770  H-Bb S-Bb L-Bb L-Mn 
4ki6 X-ray 2.55 A 368-770  H-Bb L-Bb L-Mn 
4m45 X-ray 1.89 A 368-770 None
4j2d X-ray 1.76 A 368-770  L-Bb L-Mn 
4m3t X-ray 1.9 A 368-770  L-Bb L-Mn 
4m3z X-ray 1.84 A 368-770  L-Bb L-Mn 
4m3y X-ray 1.86 A 368-770  S-Bb L-Bb L-Mn 
4m3w X-ray 2.1 A 368-770 None
4m41 X-ray 2.15 A 368-770  L-Bb 
4m3u X-ray 2.07 A 368-770  L-Bb 
2p5o X-ray 2.8 C 368-629  L-Bb 
2p5o X-ray 2.8 A 368-629  L-Bb 
2dtu X-ray 2.37 A 368-770  L-Bb 
2dtu X-ray 2.37 B 368-770  S-Bb L-Bb 
2dtu X-ray 2.37 C 368-770  L-Bb L-Mn 
2dtu X-ray 2.37 D 368-770  S-Bb 
3kd5 X-ray 2.69 E 368-770  S-Bb L-Bb L-Mn 
3kd1 X-ray 2.66 E 368-770  S-Bb L-Bb L-Mn 
3rmb X-ray 2.65 A 368-770  L-Bb L-Mn 
3rmb X-ray 2.65 B 368-770  S-Bb L-Bb L-Mn 
3rmb X-ray 2.65 C 368-770  S-Bb L-Bb L-Mn 
3rmb X-ray 2.65 D 368-770  H-Bb L-Bb L-Mn 
3rma X-ray 2.84 A 368-770  L-Bb 
3rma X-ray 2.84 B 368-770  L-Bb 
3rma X-ray 2.84 C 368-770  S-Bb L-Bb 
3rma X-ray 2.84 D 368-770  L-Bb 
2dy4 X-ray 2.65 A 368-629 None
2dy4 X-ray 2.65 B 368-629  L-Bb 
2dy4 X-ray 2.65 C 368-629  L-Bb 
2dy4 X-ray 2.65 D 368-629  L-Bb 
5gnq X-ray 2.1 B 368-770  S-Bb L-Bb L-Mn 
5gnq X-ray 2.1 A 368-770  S-Bb L-Bb L-Mn 
3rmd X-ray 2.98 A 368-770  S-Bb L-Bb 
3rmd X-ray 2.98 B 368-770 None
3rmd X-ray 2.98 C 368-770 None
3rmd X-ray 2.98 D 368-770 None
3rmc X-ray 3 A 368-770  S-Bb L-Bb L-Mn 
3rmc X-ray 3 B 368-770  S-Bb L-Bb L-Mn 
3rmc X-ray 3 C 368-770  S-Bb L-Bb L-Mn 
3rmc X-ray 3 D 368-770  H-Bb L-Bb 
2p5g X-ray 2.8 A 368-629  S-Bb L-Bb 
2p5g X-ray 2.8 C 368-629  L-Bb 
2p5g X-ray 2.8 D 368-629 None
2ozs X-ray 2.75 A 368-770  L-Bb L-Mn 
2ozm X-ray 2.86 A 368-770  S-Bb L-Bb L-Mn 
3lds X-ray 3 A 368-770  L-Bb L-Mn 


© NPIDB team 2003 - 2019

text