Pfam domain
Pfam family: Ribosomal_L5 (PF00281.18)
Uniprot AC: Q3E757
RecName: 60S ribosomal protein L11-B
Begin-End: 7-60
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
Structures of the domain Q3E757 7-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2noq X-ray 7.3 H 6-59 None
3j0q X-ray 10.6 k 7-60 None


© NPIDB team 2003 - 2019

text