Pfam domain
Pfam family: Ribosomal_S25 (PF03297.14)
Uniprot AC: Q3E792
RecName: 40S ribosomal protein S25-A
Begin-End: 42-104
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIY
TRA
Structures of the domain Q3E792 42-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 Z 42-104 None
6eml X-ray 3.6 K 42-104 None


© NPIDB team 2003 - 2019

text