Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: Q3SYS0
RecName: 39S ribosomal protein L24, mitochondrial
Begin-End: 91-154
Organism: Bos taurus
Interaction Mode:   

Sequence:
LNTHYRYVGKTVDFRGTMVPSEAPLLHNQVKLVDPMDRKPTEVEWRFTEAGERVRVSTRS
GRII
Structures of the domain Q3SYS0 91-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 N 92-154 None
3iy9 X-ray 14.1 N 1840-1902 None


© NPIDB team 2003 - 2019

text