Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: Q3SZX5
RecName: 39S ribosomal protein L22, mitochondrial
Begin-End: 67-171
Organism: Bos taurus
Interaction Mode:   

Sequence:
HCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEVLLEAQDMAVRDHNV
EFRSNLYIAESTSGRGQYLKRIRYHGRGRFGIMEKVFCHYFVKLV
Structures of the domain Q3SZX5 67-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 M 1-104 None
3iy9 X-ray 14.1 M 1598-1701 None


© NPIDB team 2003 - 2019

text