Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: Q3T0L3
RecName: 39S ribosomal protein L17, mitochondrial
Begin-End: 28-126
Organism: Bos taurus
Interaction Mode:   

Sequence:
LLQNLLTGLVRHERIEASWARVDELRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIP
KLFQVLAPRYQGQNGGYTRMLQIPNRNQQDRAKMAVIEY
Structures of the domain Q3T0L3 28-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 J 28-125 None
3iy9 X-ray 14.1 S 18-115 None


© NPIDB team 2003 - 2020

text