Pfam domain
Pfam family: RNA_pol_L (PF01193.23)
Uniprot AC: Q3T0Q3
RecName: DNA-directed RNA polymerase II subunit RPB3
Begin-End: 20-256
Organism: Bos taurus
Interaction Mode:   

Sequence:
KFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIV
DKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDP
NDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPK
PEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKL
Structures of the domain Q3T0Q3 20-256
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 C 20-256 None
5flm X-ray 3.4 C 20-256 None


© NPIDB team 2003 - 2019

text