Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: Q3UPW2
RecName: ETS-related transcription factor Elf-3
Begin-End: 294-375
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
HLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAM
RYYYKREILERVDGRRLVYKFG
Structures of the domain Q3UPW2 294-375
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jtg X-ray 2.2 A 274-354  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2019

text