Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: Q3ZBX6
RecName: 39S ribosomal protein L3, mitochondrial
Begin-End: 112-281
Organism: Bos taurus
Interaction Mode:   

Sequence:
KDGKKHVVTLLQVQDCHVLKYTPKENHNGKMAALTVGGKTVSRFHKSTSILEFYQELGLP
PKQKIKMFNVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATH
GQTKTHRRPGAISTGDVARVWPGTKMPGQLGNVDRTAFGLKVWRINTKHN
Structures of the domain Q3ZBX6 112-281
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 C 115-278 None


© NPIDB team 2003 - 2019

text