Pfam domain
Pfam family: Tnp_DNA_bind (PF14706.8)
Uniprot AC: Q46731
RecName: Transposase for transposon Tn5
Begin-End: 11-69
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
DWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGKSITISSEGSEAMQEGAYRFIRNPNV
Structures of the domain Q46731 11-69
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mus X-ray 1.9 A 11-69  H-Bb H-Mj H-Mn L-Bb 
1mm8 X-ray 2.8 A 11-69  H-Bb H-Mj H-Mn L-Bb 
4dm0 X-ray 2.5 A 11-69  H-Bb H-Mj H-Mn L-Bb 
3ecp X-ray 2.5 A 11-69  H-Bb H-Mj H-Mn L-Bb 
1muh X-ray 2.3 A 11-69  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2021

text