Pfam domain
Pfam family: DDE_Tnp_1 (PF01609.23)
Uniprot AC: Q46731
RecName: Transposase for transposon Tn5
Begin-End: 124-362
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
WWVHSVLLLEATTFRTVGLLHQEWWMRPDDPADADEKESGKWLAAAATSRLRMGSMMSNV
IAVCDREADIHAYLQDKLAHNERFVVRSKHPRKDVESGLYLYDHLKNQPELGGYQISIPQ
KGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNAVLAEEINPPKGETPLKWLLLTS
EPVESLAQALRVIDIYTHRWRIEEFHKAWKTGAGAERQRMEEPDNLERMVSILSFVAVR
Structures of the domain Q46731 124-362
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mus X-ray 1.9 A 124-362  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
1mm8 X-ray 2.8 A 124-362  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
4dm0 X-ray 2.5 A 124-362  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
3ecp X-ray 2.5 A 124-362  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
1muh X-ray 2.3 A 124-362  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text