Pfam domain
Pfam family: Cas_Cas1 (PF01867.15)
Uniprot AC: Q46896
RecName: CRISPR-associated endonuclease Cas1
Begin-End: 122-240
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
LRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRYDPKDWEKGDTINQCIS
AATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVYDIADIIKFDTVVPKAFEIARRNP
Structures of the domain Q46896 122-240
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ds5 X-ray 2.95 D 130-228 None
5ds5 X-ray 2.95 D 25-121 None
5ds5 X-ray 2.95 C 130-228 None
5ds5 X-ray 2.95 C 25-121  L-Bb L-Mj 
5ds5 X-ray 2.95 B 130-228 None
5ds5 X-ray 2.95 B 25-121 None
5ds5 X-ray 2.95 A 25-121  H-Bb L-Bb L-Mj 
5ds5 X-ray 2.95 A 130-228 None
5vvk X-ray 2.9 A 25-121  H-Bb L-Bb L-Mj 
5vvk X-ray 2.9 A 130-228 None
5vvk X-ray 2.9 D 129-228 None
5vvk X-ray 2.9 D 25-121 None
5vvk X-ray 2.9 C 130-228 None
5vvk X-ray 2.9 C 25-121  H-Bb L-Bb L-Mj 
5vvk X-ray 2.9 B 130-228 None
5vvk X-ray 2.9 B 25-121 None
5dqu X-ray 4.5 B 130-228 None
5dqu X-ray 4.5 C 25-121 None
5dqu X-ray 4.5 C 130-228 None
5dqu X-ray 4.5 A 130-228 None
5dqu X-ray 4.5 D 25-120 None
5dqu X-ray 4.5 D 131-228 None
5dqu X-ray 4.5 A 25-121 None
5dqu X-ray 4.5 B 25-121 None
5dqz X-ray 2.7 B 130-228 None
5dqz X-ray 2.7 A 130-228 None
5dqz X-ray 2.7 A 25-121  H-Bb S-Bb L-Bb 
5dqz X-ray 2.7 C 130-228 None
5dqz X-ray 2.7 D 25-121  H-Bb S-Bb L-Bb 
5dqz X-ray 2.7 D 130-228 None
5ds6 X-ray 3.35 C 130-228 None
5ds6 X-ray 3.35 C 25-121  H-Bb S-Bb L-Bb 
5ds6 X-ray 3.35 B 129-228 None
5ds6 X-ray 3.35 B 25-121  S-Bb L-Bb 
5ds6 X-ray 3.35 A 25-121  H-Bb S-Bb L-Bb 
5ds6 X-ray 3.35 A 130-228 None
5vvl X-ray 3.31 A 25-121  H-Bb L-Bb L-Mj 
5vvl X-ray 3.31 A 130-228 None
5vvl X-ray 3.31 B 25-121 None
5vvl X-ray 3.31 B 130-228 None
5vvl X-ray 3.31 D 130-228 None
5vvl X-ray 3.31 D 25-121 None
5vvl X-ray 3.31 C 130-228 None
5vvl X-ray 3.31 C 25-121  H-Bb L-Bb L-Mj 
5dlj X-ray 2.6 B 130-228 None
5dlj X-ray 2.6 B 25-121  S-Bb L-Bb 
5dlj X-ray 2.6 A 130-228 None
5dlj X-ray 2.6 A 25-121  H-Bb S-Bb L-Bb 
5dlj X-ray 2.6 C 130-228 None
5dlj X-ray 2.6 C 25-121  S-Bb L-Bb 
5dlj X-ray 2.6 D 25-121  H-Bb S-Bb L-Bb 
5dlj X-ray 2.6 D 130-228 None
5ds4 X-ray 3.2 C 130-228 None
5ds4 X-ray 3.2 C 25-121  H-Bb L-Bb 
5ds4 X-ray 3.2 B 129-228 None
5ds4 X-ray 3.2 B 25-121 None
5ds4 X-ray 3.2 A 25-121  H-Bb L-Bb L-Mj 
5ds4 X-ray 3.2 A 130-228 None
5dqt X-ray 3.1 B 130-228 None
5dqt X-ray 3.1 B 21-121 None
5dqt X-ray 3.1 A 130-228 None
5dqt X-ray 3.1 A 25-121  H-Bb L-Bb 
5dqt X-ray 3.1 C 130-228 None
5dqt X-ray 3.1 D 130-228 None
5dqt X-ray 3.1 C 25-121 None
5dqt X-ray 3.1 D 25-121 None
5dqt X-ray 3.1 J 130-228 None
5dqt X-ray 3.1 J 25-121 None
5dqt X-ray 3.1 I 130-228 None
5dqt X-ray 3.1 I 25-121  H-Bb L-Bb 
5dqt X-ray 3.1 K 130-228 None
5dqt X-ray 3.1 L 130-228 None
5dqt X-ray 3.1 K 25-121 None
5dqt X-ray 3.1 L 25-121 None
5vvj X-ray 3.89 A 130-228 None
5vvj X-ray 3.89 A 25-121  H-Bb L-Bb L-Mj 
5vvj X-ray 3.89 D 130-228 None
5vvj X-ray 3.89 D 25-121 None
5vvj X-ray 3.89 C 130-228 None
5vvj X-ray 3.89 C 25-121  H-Bb L-Bb L-Mj 
5vvj X-ray 3.89 B 130-228 None
5vvj X-ray 3.89 B 25-121 None
5wfe X-ray 3.64 D 130-228 None
5wfe X-ray 3.64 D 25-121  S-Bb L-Bb 
5wfe X-ray 3.64 C 130-228 None
5wfe X-ray 3.64 C 25-121  H-Bb S-Bb L-Bb L-Mj 
5wfe X-ray 3.64 B 130-228  L-Bb L-Mn 
5wfe X-ray 3.64 B 25-121  H-Bb S-Bb L-Bb 
5wfe X-ray 3.64 A 130-228  H-Bb H-Mn L-Bb 
5wfe X-ray 3.64 A 25-121  H-Bb S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text