Pfam domain
Pfam family: Cas_Cas5d (PF09704.9)
Uniprot AC: Q46898
RecName: CRISPR system Cascade subunit CasD
Begin-End: 4-217
Organism: Escherichia coli
Interaction Mode:   

Sequence:
YLILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSESVQF
AVRCDELILDDRRVSVTGLRDYHTVLGAREDYRGLKSHETIQTWREYLCDASFTVALWLT
PHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQASDPQKALLNYEPVGGDIYS
EESVTGHHLKFTARDEPMITLPRQFASREWYVIK
Structures of the domain Q46898 4-217
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qyz X-ray 3.03 J 4-185 None
4u7u X-ray 3 W 4-179 None
4u7u X-ray 3 K 4-179 None
4u7u X-ray 3 K 4-179 None
4u7u X-ray 3 W 4-179 None
5cd4 X-ray 3.2 T 4-179 None
5cd4 X-ray 3.2 H 4-179 None
5h9e X-ray 3.21 J 4-179 None
5h9f X-ray 2.45 J 4-179 None


© NPIDB team 2003 - 2019

text