Pfam domain
Pfam family: Cas_CT1975 (PF09344.9)
Uniprot AC: Q46899
RecName: CRISPR system Cascade subunit CasC
Begin-End: 5-358
Organism: Escherichia coli
Interaction Mode:   

Sequence:
INIHVLISHSPSCLNRDDMNMQKDAIFGGKRRVRISSQSLKRAMRKSGYYAQNIGESSLR
TIHLAQLRDVLRQKLGERFDQKIIDKTLALLSGKSVDEAEKISADAVTPWVVGEIAWFCE
QVAKAEADNLDDKKLLKVLKEDIAAIRVNLQQGVDIALSGRMATSGMMTELGKVDGAMSI
AHAITTHQVDSDIDWFTAVDDLQEQGSAHLGTQEFSSGVFYRYANINLAQLQENLGGASR
EQALEIATHVVHMLATEVPGAKQRTYAAFNPADMVMVNFSDMPLSMANAFEKAVKAKDGF
LQPSIQAFNQYWDRVANGYGLNGAAAQFSLSDVDPITAQVKQMPTLEQLKSWVR
Structures of the domain Q46899 5-358
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qyz X-ray 3.03 H 5-346 None
4qyz X-ray 3.03 G 5-347 None
4qyz X-ray 3.03 F 5-352 None
4qyz X-ray 3.03 E 5-352 None
4u7u X-ray 3 V 5-352 None
4u7u X-ray 3 U 5-352 None
4u7u X-ray 3 T 5-347 None
4u7u X-ray 3 R 5-352 None
4u7u X-ray 3 S 5-346 None
4u7u X-ray 3 Q 5-350 None
4u7u X-ray 3 V 5-352 None
4u7u X-ray 3 U 5-352 None
4u7u X-ray 3 T 5-347 None
4u7u X-ray 3 R 5-352 None
4u7u X-ray 3 S 5-346 None
4u7u X-ray 3 Q 5-350 None
4u7u X-ray 3 J 5-352 None
4u7u X-ray 3 I 5-352 None
4u7u X-ray 3 H 5-352 None
4u7u X-ray 3 G 5-350 None
4u7u X-ray 3 F 5-352 None
4u7u X-ray 3 E 5-350 None
4u7u X-ray 3 I 5-352 None
4u7u X-ray 3 J 5-352 None
4u7u X-ray 3 H 5-352 None
4u7u X-ray 3 G 5-350 None
4u7u X-ray 3 F 5-352 None
4u7u X-ray 3 E 5-350 None
5cd4 X-ray 3.2 G 5-352 None
5cd4 X-ray 3.2 F 5-352 None
5cd4 X-ray 3.2 C 5-338 None
5cd4 X-ray 3.2 B 5-352 None
5cd4 X-ray 3.2 D 5-349 None
5cd4 X-ray 3.2 E 5-352 None
5cd4 X-ray 3.2 R 5-347 None
5cd4 X-ray 3.2 S 5-352 None
5cd4 X-ray 3.2 Q 5-347 None
5cd4 X-ray 3.2 O 5-350 None
5cd4 X-ray 3.2 P 5-352 None
5cd4 X-ray 3.2 N 5-352 None
5h9e X-ray 3.21 I 5-352 None
5h9e X-ray 3.21 H 5-346 None
5h9e X-ray 3.21 G 5-350 None
5h9e X-ray 3.21 F 5-352 None
5h9e X-ray 3.21 E 5-350 None
5h9e X-ray 3.21 D 5-219 None
5h9f X-ray 2.45 I 5-352 None
5h9f X-ray 2.45 H 5-346 None
5h9f X-ray 2.45 F 5-352 None
5h9f X-ray 2.45 G 5-350 None
5h9f X-ray 2.45 E 5-350 None
5h9f X-ray 2.45 D 5-219 None


© NPIDB team 2003 - 2019

text