Pfam domain
Pfam family: RE_Eco29kI (PF09517.12)
Uniprot AC: Q46944
RecName: Eco29kIR
Begin-End: 41-208
Organism: Escherichia coli
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
ERFQGAGVYALYYTGHYSLYDEYSRINRLAYNLPIYVGKAVPAGWRQSRISDHETRAGSE
LSNRIREHGRNIAKTSNLDLCDFSCRFVIFEATGSDMISTVEAALIKIYKPLWNTVVDGF
GNHTPGAGRFAQAKSDWDVIHPGREWAEKCTGVHSEPYFIEERIKQYF
Structures of the domain Q46944 41-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3nic X-ray 2.8 A 41-208  S-Bb L-Bb L-Mj 
3nic X-ray 2.8 H 41-208  H-Bb S-Bb L-Bb L-Mj L-Mn 
3nic X-ray 2.8 C 41-208  H-Bb S-Bb L-Bb L-Mj L-Mn 
3nic X-ray 2.8 G 41-208  S-Bb L-Bb L-Mj L-Mn 
3nic X-ray 2.8 B 41-208  H-Bb S-Bb L-Bb L-Mj 
3nic X-ray 2.8 D 41-208  H-Bb S-Bb L-Bb L-Mj L-Mn 
3nic X-ray 2.8 E 41-208  H-Bb S-Bb L-Bb L-Mj 
3nic X-ray 2.8 F 41-208  H-Bb S-Bb L-Bb L-Mj L-Mn 
3mx4 X-ray 2.5 A 41-208  H-Bb S-Bb L-Bb L-Mj L-Mn 
3mx4 X-ray 2.5 H 41-208  S-Bb L-Bb L-Mj L-Mn 
3mx4 X-ray 2.5 D 41-208  H-Bb S-Bb L-Bb L-Mj L-Mn 
3mx4 X-ray 2.5 F 41-208  H-Bb S-Bb L-Bb L-Mj L-Mn 
3mx4 X-ray 2.5 G 41-208  H-Bb S-Bb L-Bb L-Mj 
3mx4 X-ray 2.5 C 41-208  H-Bb S-Bb L-Bb L-Mj L-Mn 
3mx4 X-ray 2.5 B 41-208  H-Bb S-Bb L-Bb L-Mj 
3mx4 X-ray 2.5 E 41-208  H-Bb S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text