Pfam domain
Pfam family: IMS_HHH (PF11798.7)
Uniprot AC: Q47155
RecName: DNA polymerase IV
Begin-End: 166-197
Organism: Escherichia coli
Interaction Mode:  H-Bb L-Bb 

Sequence:
PAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGL
Structures of the domain Q47155 166-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r8u X-ray 2.3 A 167-198  H-Bb L-Bb 
4r8u X-ray 2.3 B 167-198  H-Bb L-Bb 
4ir9 X-ray 2.33 F 166-197  H-Bb L-Bb 
4ir9 X-ray 2.33 A 166-197  H-Bb L-Bb 
4irc X-ray 2.67 A 166-197  H-Bb L-Bb 
4irc X-ray 2.67 F 166-197 None
4irk X-ray 2.32 A 166-197  H-Bb L-Bb 
4irk X-ray 2.32 B 166-197 None
4ird X-ray 2.48 F 166-197  H-Bb L-Bb 
4ird X-ray 2.48 A 166-197  H-Bb L-Bb 
4ir1 X-ray 2.38 F 166-197  H-Bb L-Bb 
4ir1 X-ray 2.38 A 166-197  H-Bb L-Bb 
4q45 X-ray 2.18 A 166-197 None
4q45 X-ray 2.18 F 166-197 None
4q43 X-ray 2.45 A 166-197  H-Bb L-Bb 
4q43 X-ray 2.45 F 166-197  H-Bb L-Bb 
4q44 X-ray 2.71 A 166-197  H-Bb L-Bb 
4q44 X-ray 2.71 F 166-197  H-Bb L-Bb 
5c5j X-ray 2.1 F 166-197  H-Bb L-Bb 
5c5j X-ray 2.1 A 166-197  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text