Pfam domain
Pfam family: IMS_HHH (PF11798.7)
Uniprot AC: Q47155
RecName: DNA polymerase IV
Begin-End: 166-197
Organism: Escherichia coli
Interaction Mode:  H-Bb L-Bb 

Sequence:
PAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGL
Structures of the domain Q47155 166-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r8u X-ray 2.3 B 167-198  H-Bb L-Bb 
4r8u X-ray 2.3 A 167-198  H-Bb L-Bb 
4ir9 X-ray 2.33 F 166-197  H-Bb L-Bb 
4ir9 X-ray 2.33 A 166-197  H-Bb L-Bb 
5yus X-ray 1.94 A 166-197  H-Bb L-Bb 
5yus X-ray 1.94 F 166-197  H-Bb L-Bb 
5yyd X-ray 2.05 A 166-197  H-Bb L-Bb 
5yyd X-ray 2.05 F 166-197  H-Bb L-Bb 
5yye X-ray 2.33 A 166-197  H-Bb L-Bb 
5yye X-ray 2.33 F 166-197  H-Bb L-Bb 
5yuy X-ray 1.74 A 166-197  H-Bb L-Bb 
5yuy X-ray 1.74 F 166-197  H-Bb L-Bb 
4irc X-ray 2.67 F 166-197  H-Bb L-Bb 
4irc X-ray 2.67 A 166-197  H-Bb L-Bb 
4irk X-ray 2.32 A 166-197  H-Bb L-Bb 
4irk X-ray 2.32 B 166-197  H-Bb L-Bb 
4ird X-ray 2.48 F 166-197  H-Bb L-Bb 
4ird X-ray 2.48 A 166-197  H-Bb L-Bb 
4ir1 X-ray 2.38 F 166-197  H-Bb L-Bb 
4ir1 X-ray 2.38 A 166-197  H-Bb L-Bb 
5yux X-ray 2.04 F 166-197  H-Bb L-Bb 
5yux X-ray 2.04 A 166-197  H-Bb L-Bb 
5yut X-ray 2.15 A 166-197  H-Bb L-Bb 
5yut X-ray 2.15 F 166-197  H-Bb L-Bb 
4q43 X-ray 2.45 A 166-197  H-Bb L-Bb 
4q43 X-ray 2.45 F 166-197  H-Bb L-Bb 
4q44 X-ray 2.71 A 166-197  H-Bb L-Bb 
4q44 X-ray 2.71 F 166-197  H-Bb L-Bb 
4q45 X-ray 2.18 A 166-197 None
4q45 X-ray 2.18 F 166-197 None
5yuu X-ray 1.89 F 166-197  H-Bb L-Bb 
5yuu X-ray 1.89 A 166-197  H-Bb L-Bb 
5c5j X-ray 2.1 A 166-197  H-Bb L-Bb 
5c5j X-ray 2.1 F 166-197  H-Bb L-Bb 
5yuw X-ray 2.12 F 166-197  H-Bb L-Bb 
5yuw X-ray 2.12 A 166-197  H-Bb L-Bb 
5yur X-ray 2.04 A 166-197  H-Bb L-Bb 
5yur X-ray 2.04 F 166-197  H-Bb L-Bb 
5zlv X-ray 2.35 A 166-197  H-Bb L-Bb 
5zlv X-ray 2.35 F 166-197  H-Bb L-Bb 
5yv0 X-ray 2.09 A 166-197  H-Bb L-Bb 
5yv0 X-ray 2.09 F 166-197  H-Bb L-Bb 
5yv2 X-ray 1.9 A 166-197  H-Bb L-Bb 
5yv2 X-ray 1.9 F 166-197  H-Bb L-Bb 
5yv3 X-ray 2.03 A 166-197  H-Bb L-Bb 
5yv3 X-ray 2.03 F 166-197  H-Bb L-Bb 
5yv1 X-ray 2.09 A 166-197  H-Bb L-Bb 
5yv1 X-ray 2.09 F 166-197  H-Bb L-Bb 
5yuz X-ray 1.83 A 166-197  H-Bb L-Bb 
5yuz X-ray 1.83 F 166-197  H-Bb L-Bb 
6ig1 X-ray 1.97 F 166-197  H-Bb L-Bb 
6ig1 X-ray 1.97 A 166-197  H-Bb L-Bb 
5yuv X-ray 2.06 F 166-197  H-Bb L-Bb 
5yuv X-ray 2.06 A 166-197  H-Bb L-Bb 


© NPIDB team 2003 - 2020

text