Pfam domain
Pfam family: IMS_C (PF11799.7)
Uniprot AC: Q47155
RecName: DNA polymerase IV
Begin-End: 234-341
Organism: Escherichia coli
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
VNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFD
DFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDP
Structures of the domain Q47155 234-341
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r8u X-ray 2.3 A 238-340  H-Bb S-Bb L-Bb 
4r8u X-ray 2.3 B 238-338  H-Bb S-Bb L-Bb 
4ir9 X-ray 2.33 F 237-340  H-Bb S-Bb L-Bb 
4ir9 X-ray 2.33 A 237-340  H-Bb S-Bb L-Bb 
4irc X-ray 2.67 A 237-340  H-Bb S-Bb L-Bb 
4irc X-ray 2.67 F 237-340 None
4irk X-ray 2.32 A 237-340  H-Bb S-Bb L-Bb 
4irk X-ray 2.32 B 237-340 None
4ird X-ray 2.48 F 237-340  H-Bb S-Bb L-Bb 
4ird X-ray 2.48 A 237-340  H-Bb S-Bb L-Bb 
4ir1 X-ray 2.38 F 237-340  H-Bb S-Bb L-Bb 
4ir1 X-ray 2.38 A 237-340  H-Bb S-Bb L-Bb 
4q45 X-ray 2.18 A 237-340  H-Bb S-Bb L-Bb 
4q45 X-ray 2.18 F 237-340 None
4q43 X-ray 2.45 A 237-340  H-Bb S-Bb L-Bb 
4q43 X-ray 2.45 F 237-340  H-Bb S-Bb L-Bb 
4q44 X-ray 2.71 A 237-340  H-Bb S-Bb L-Bb 
4q44 X-ray 2.71 F 237-340  H-Bb S-Bb L-Bb 
5c5j X-ray 2.1 F 237-340  H-Bb S-Bb L-Bb 
5c5j X-ray 2.1 A 237-340  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text