Pfam domain
Pfam family: IMS (PF00817.22)
Uniprot AC: Q47155
RecName: DNA polymerase IV
Begin-End: 7-154
Organism: Escherichia coli
Interaction Mode:  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 

Sequence:
VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLC
PHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEI
RQTIFNELQLTASAGVAPVKFLAKIASD
Structures of the domain Q47155 7-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r8u X-ray 2.3 B 8-155  S-Bb L-Bb 
4r8u X-ray 2.3 A 8-155  H-Bb S-Bb 
4ir9 X-ray 2.33 F 7-154  H-Bb S-Bb L-Bb 
4ir9 X-ray 2.33 A 7-154  H-Bb S-Bb 
5yus X-ray 1.94 A 7-154  H-Bb S-Bb L-Bb 
5yus X-ray 1.94 F 7-154  H-Bb S-Bb L-Bb 
5yyd X-ray 2.05 A 7-154  H-Bb S-Bb 
5yyd X-ray 2.05 F 7-154  H-Bb S-Bb L-Bb 
5yye X-ray 2.33 A 7-154  H-Bb S-Bb L-Bb 
5yye X-ray 2.33 F 7-154  H-Bb S-Bb L-Bb 
5yuy X-ray 1.74 A 7-154  H-Bb S-Bb 
5yuy X-ray 1.74 F 7-154  H-Bb S-Bb 
4irc X-ray 2.67 F 7-154  H-Bb S-Bb L-Bb 
4irc X-ray 2.67 A 7-154  H-Bb S-Bb L-Bb 
4irk X-ray 2.32 A 7-154  H-Bb 
4irk X-ray 2.32 B 7-154  H-Bb S-Bb 
4ird X-ray 2.48 F 7-154  H-Bb S-Bb L-Bb 
4ird X-ray 2.48 A 7-154  H-Bb S-Bb L-Bb 
4ir1 X-ray 2.38 F 7-154  H-Bb S-Bb L-Bb 
4ir1 X-ray 2.38 A 7-154  H-Bb S-Bb L-Bb 
5yux X-ray 2.04 F 7-154  H-Bb S-Bb 
5yux X-ray 2.04 A 7-154  H-Bb S-Bb 
5yut X-ray 2.15 A 7-154  H-Bb S-Bb L-Bb 
5yut X-ray 2.15 F 7-154  H-Bb S-Bb L-Bb 
4q43 X-ray 2.45 A 7-154  H-Bb S-Bb L-Bb 
4q43 X-ray 2.45 F 7-154  H-Bb S-Bb 
4q44 X-ray 2.71 A 7-154  S-Bb L-Bb 
4q44 X-ray 2.71 F 7-154  S-Bb L-Bb 
4q45 X-ray 2.18 A 7-154  S-Bb L-Bb 
4q45 X-ray 2.18 F 7-154  S-Bb L-Bb 
5yuu X-ray 1.89 F 7-154  H-Bb S-Bb L-Bb 
5yuu X-ray 1.89 A 7-154  H-Bb S-Bb L-Bb 
5c5j X-ray 2.1 A 7-154  H-Bb S-Bb 
5c5j X-ray 2.1 F 7-154  H-Bb S-Bb 
6juq X-ray 2.74 F 7-154  H-Bb S-Bb L-Bb 
6juq X-ray 2.74 A 7-154  H-Bb L-Bb 
6jup X-ray 2.44 F 7-154  S-Bb L-Bb 
6jup X-ray 2.44 A 7-154  L-Bb 
5yuw X-ray 2.12 F 7-154  H-Bb 
5yuw X-ray 2.12 A 7-154  H-Bb S-Bb 
5yur X-ray 2.04 A 7-154  H-Bb S-Bb L-Bb 
5yur X-ray 2.04 F 7-154  H-Bb S-Bb L-Bb 
5zlv X-ray 2.35 A 7-154  H-Bb S-Bb S-Mj S-Mn L-Mj 
5zlv X-ray 2.35 F 7-154  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 
5yv0 X-ray 2.09 A 7-154  H-Bb S-Bb 
5yv0 X-ray 2.09 F 7-154  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 
5yv2 X-ray 1.9 A 7-154  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 
5yv2 X-ray 1.9 F 7-154  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 
5yv3 X-ray 2.03 A 7-154  H-Bb 
5yv3 X-ray 2.03 F 7-154  H-Bb 
5yv1 X-ray 2.09 A 7-154  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 
5yv1 X-ray 2.09 F 7-154  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 
5yuz X-ray 1.83 A 7-154  H-Bb 
5yuz X-ray 1.83 F 7-154  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj 
6ig1 X-ray 1.97 F 7-154  H-Bb S-Bb 
6ig1 X-ray 1.97 A 7-154  H-Bb S-Bb 
5yuv X-ray 2.06 F 7-154  H-Bb S-Bb 
5yuv X-ray 2.06 A 7-154  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text