Pfam domain
Pfam family: IMS (PF00817.19)
Uniprot AC: Q47155
RecName: DNA polymerase IV
Begin-End: 7-154
Organism: Escherichia coli
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLC
PHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEI
RQTIFNELQLTASAGVAPVKFLAKIASD
Structures of the domain Q47155 7-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r8u X-ray 2.3 A 8-155  H-Bb S-Bb 
4r8u X-ray 2.3 B 8-155  S-Bb L-Bb 
4ir9 X-ray 2.33 F 7-154  S-Bb L-Bb 
4ir9 X-ray 2.33 A 7-154  H-Bb S-Bb 
4irc X-ray 2.67 A 7-154  H-Bb S-Bb L-Bb 
4irc X-ray 2.67 F 7-154 None
4irk X-ray 2.32 A 7-154  H-Bb 
4irk X-ray 2.32 B 7-154 None
4ird X-ray 2.48 F 7-154  H-Bb S-Bb L-Bb 
4ird X-ray 2.48 A 7-154  H-Bb S-Bb L-Bb 
4ir1 X-ray 2.38 F 7-154  H-Bb S-Bb L-Bb 
4ir1 X-ray 2.38 A 7-154  H-Bb S-Bb L-Bb 
4q45 X-ray 2.18 A 7-154 None
4q45 X-ray 2.18 F 7-154 None
4q43 X-ray 2.45 A 7-154  H-Bb S-Bb L-Bb 
4q43 X-ray 2.45 F 7-154  H-Bb S-Bb 
4q44 X-ray 2.71 A 7-154 None
4q44 X-ray 2.71 F 7-154 None
5c5j X-ray 2.1 F 7-154  H-Bb S-Bb 
5c5j X-ray 2.1 A 7-154  S-Bb 


© NPIDB team 2003 - 2019

text