Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: Q47PJ0
RecName: CRISPR-associated helicase, Cas3 family
Begin-End: 567-694
Organism: Thermobifida fusca
Interaction Mode:   

Sequence:
RSTVLAKELTPLVKQGGCAAIICTTVAEAQGVYDLLSQWFATLGEDAPDLYLLHSRFPNR
QRTEITATIVDLFGKEGAQSGRRPTRGAVLVATQVVEQSLDLDVDLMISDLAPVSLLLQR
AGRCWRHE
Structures of the domain Q47PJ0 567-694
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qqy X-ray 3.12 C 577-693 None
4qqy X-ray 3.12 A 577-693 None
4qqy X-ray 3.12 G 577-693 None
4qqy X-ray 3.12 E 577-693 None
4qqy X-ray 3.12 C 577-693 None
4qqy X-ray 3.12 A 577-693 None
4qqy X-ray 3.12 G 577-693 None
4qqy X-ray 3.12 E 577-693 None
4qqz X-ray 2.93 G 577-693 None
4qqz X-ray 2.93 C 577-693 None
4qqz X-ray 2.93 A 577-693 None
4qqz X-ray 2.93 G 577-693 None
4qqz X-ray 2.93 E 577-693 None
4qqz X-ray 2.93 A 577-693 None
4qqz X-ray 2.93 C 577-693 None
4qqz X-ray 2.93 E 577-693 None
4qqw X-ray 2.66 C 577-693 None
4qqw X-ray 2.66 A 577-693 None
4qqw X-ray 2.66 G 577-693 None
4qqw X-ray 2.66 E 577-693 None
4qqw X-ray 2.66 C 577-693 None
4qqw X-ray 2.66 A 577-693 None
4qqw X-ray 2.66 G 577-693 None
4qqw X-ray 2.66 E 577-693 None
4qqx X-ray 3.34 C 577-693 None
4qqx X-ray 3.34 A 577-693 None
4qqx X-ray 3.34 G 580-693 None
4qqx X-ray 3.34 E 577-693 None
4qqx X-ray 3.34 A 577-693 None
4qqx X-ray 3.34 C 577-693 None
4qqx X-ray 3.34 E 577-693 None
4qqx X-ray 3.34 G 580-693 None


© NPIDB team 2003 - 2019

text