Pfam domain
Pfam family: CRISPR_Cse1 (PF09481.9)
Uniprot AC: Q47PJ1
RecName: CRISPR-associated protein, Cse1 family
Begin-End: 21-511
Organism: Thermobifida fusca
Interaction Mode:  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 

Sequence:
DVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARIT
GLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLRE
ECPKTSGVNKLAWGRTAGENQVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTAR
VVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPGTGAADLAFWEQPELNDPLGL
PEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKE
GRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFD
QDGQARDKQWFTATTPAVLRWLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEA
WKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPVFWNIVYDRPAQGYTPGMAGP
GNAFNLVALAA
Structures of the domain Q47PJ1 21-511
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u0a X-ray 3.3 C 25-487 None
5u07 X-ray 3.8 C 25-487  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text