Pfam domain
Pfam family: CRISPR_Cse2 (PF09485.9)
Uniprot AC: Q47PJ2
RecName: Uncharacterized protein
Begin-End: 27-218
Organism: Thermobifida fusca
Interaction Mode:   

Sequence:
ARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPTDYDVDRRRAASLWDVHAVERAFYAVAA
IMAAQPRSARDQEAEATEEQTGEPQDSEALTEPTPAEESSATKDGKPDRRPNLGVSLAQA
VFDKGLNADSTEQRLHLIARQNLDGVHRHLPRLVLYLRSDQVHIDWGILIRDLARWGHTP
RHVAREWVQDYH
Structures of the domain Q47PJ2 27-218
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u0a X-ray 3.3 L 27-218 None
5u0a X-ray 3.3 J 27-218 None
5u07 X-ray 3.8 J 27-218 None
5u07 X-ray 3.8 B 27-218 None


© NPIDB team 2003 - 2019

text