Pfam domain
Pfam family: Cas_CT1975 (PF09344.9)
Uniprot AC: Q47PJ3
RecName: CRISPR-associated protein, Cse4 family
Begin-End: 4-364
Organism: Thermobifida fusca
Interaction Mode:   

Sequence:
VDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKAVRTR
RIISEIAKRLRERGWDADLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFYLPVPA
IDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVLKSRNVSVNLFGRMLAELPSTEVD
GAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYANVNLDRLV
ENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPISFAPAFETA
LYGSDGYTLRACQELNNYAERLREVWPDDAIRGYATVENKTDLAALGERYDSYPALIDAM
V
Structures of the domain Q47PJ3 4-364
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u0a X-ray 3.3 H 4-353 None
5u0a X-ray 3.3 G 4-353 None
5u0a X-ray 3.3 F 4-353 None
5u0a X-ray 3.3 E 4-353 None
5u07 X-ray 3.8 H 4-353 None
5u07 X-ray 3.8 G 4-353 None
5u07 X-ray 3.8 F 4-353 None
5u07 X-ray 3.8 E 4-353 None


© NPIDB team 2003 - 2019

text