Pfam domain
Pfam family: Cas_Cas5d (PF09704.9)
Uniprot AC: Q47PJ4
RecName: CRISPR-associated protein, Cas5e family
Begin-End: 3-220
Organism: Thermobifida fusca
Interaction Mode:  L-Bb 

Sequence:
GFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKFTVR
VDRPGVRLVDFHTIGGGLPKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVTGPEA
DTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVRELVEAVPLPHRRVEEDAATVLV
DLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIR
Structures of the domain Q47PJ4 3-220
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u0a X-ray 3.3 N 4-219 None
5u07 X-ray 3.8 N 4-219  L-Bb 


© NPIDB team 2003 - 2019

text