Pfam domain
Pfam family: CRISPR_assoc (PF08798.10)
Uniprot AC: Q47PJ5
RecName: CRISPR-associated protein, Cse3 family
Begin-End: 2-224
Organism: Thermobifida fusca
Interaction Mode:   

Sequence:
TWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETRNE
LYLLVQSHSPLRVDRLGPGYHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSENNT
QRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLELLSTYAQTLDDVRDPGTADRSR
KIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLA
Structures of the domain Q47PJ5 2-224
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u0a X-ray 3.3 A 20-224 None
5u07 X-ray 3.8 A 3-224 None


© NPIDB team 2003 - 2019

text