Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: Q4D4S1
RecName: 40S ribosomal protein S9, putative
Begin-End: 5-105
Organism: Trypanosoma cruzi
Interaction Mode:   

Sequence:
NNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRVNMTLSKMRRTARLLLTLPEN
HPRRQLEGSAIMRRCHDYGFLEEEKDKLDYVLSLTVPDILE
Structures of the domain Q4D4S1 5-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5opt X-ray 4 b 16-61 None


© NPIDB team 2003 - 2019

text