Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: Q4DK40
RecName: 40S ribosomal protein S17, putative
Begin-End: 58-175
Organism: Trypanosoma cruzi
Interaction Mode:   

Sequence:
KIRTKTVKRASKQLVEKYFSKLNKDFYQNKRVVMDVTIARSKKLKNKIAGYTTHIMKRLA
RGPVRGISLKLQEEERERRMDYVPEVSHVDQAIQDGVHVDKQTFSMLKRMETGVPRHV
Structures of the domain Q4DK40 58-175
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5opt X-ray 4 k 58-173 None


© NPIDB team 2003 - 2019

text