Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: Q4DMK9
RecName: 40S ribosomal protein S3, putative
Begin-End: 19-95
Organism: Trypanosoma cruzi
Interaction Mode:   

Sequence:
ELFEFLKRELADDGFAGVEHRVTSTRTEIVIRATKTREVLGEKGRRIRELTACLQQRFHY
KEGKLQLFAERVEVRGL
Structures of the domain Q4DMK9 19-95
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5opt X-ray 4 m 21-90 None


© NPIDB team 2003 - 2019

text