Pfam domain
Pfam family: UvdE (PF03851.16)
Uniprot AC: Q4J9T1
RecName: UV damage endonuclease
Begin-End: 3-259
Organism: Sulfolobus acidocaldarius
Interaction Mode:  H-Bb L-Bb L-Mj L-Mn 

Sequence:
VGYVSTNYSLGCKADKTIKLSSLSEERVLKVSSSNLLCLKNILEWNLKHEILFFRISSNT
IPLASHPKFHVNWKDKLSHILGDIGDFIKENSIRISMHPGQYVVLNSVREEVVRSSIMEL
KYHADLLDSMGIEGKIQIHVGSSMNGKEESLNRFIENFRKLPSNISKRLVIENDDKVFSV
KDCLWISERTGIPVIFDNLHHSILNNGESLNDALSLVRRTWKDRPMIDYSEQEPGEKPGV
HATTINEENFRRFVNEV
Structures of the domain Q4J9T1 3-259
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gle X-ray 2.7 A 3-259  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text