Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: Q4VWW5
RecName: Ribosomal protein 3/homing endonuclease-like protein fusion
Begin-End: 583-685
Organism: Ophiostoma novo-ulmi subsp. americana
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LAGFTSGEGCFFVNLIKSKSKLGVQVQLVFSITQHIKDKNLMNSLITYLGCGYIKEKNKS
EFSWLDFVVTKFSDINDKIIPVFQENTLIGVKLEDFEDWCKVA
Structures of the domain Q4VWW5 583-685
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3qqy X-ray 2.4 A 171-272  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text