Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: Q51422
RecName: Aspartate--tRNA(Asp/Asn) ligase
Begin-End: 19-104
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
VTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDRAETFAKADRVRSEFVVKITGKVRL
RPEGARNPNMASGSIEVLGYELEVLN
Structures of the domain Q51422 19-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wj3 X-ray 3.71 M 19-104 None
4wj3 X-ray 3.71 N 19-104 None
4wj3 X-ray 3.71 P 19-104 None
4wj3 X-ray 3.71 O 19-104 None
4wj4 X-ray 3.29 A 19-104 None


© NPIDB team 2003 - 2021

text