Pfam domain
Pfam family: RepB_primase (PF16793.4)
Uniprot AC: Q52349
RecName: Replication protein B
Begin-End: 10-198
Organism: Escherichia coli
Interaction Mode:   

Sequence:
IGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQE
RHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQIARTLAS
EYDADPASADSRHYGRLAGFTNRKDKHTTRAGYQPWVLLRESKGKTATAGPALVQQAGQQ
IEQAQRQQE
Structures of the domain Q52349 10-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3h25 X-ray 2.7 A 24-196 None


© NPIDB team 2003 - 2019

text