Pfam domain
Pfam family: zf-UBP (PF02148.18)
Uniprot AC: Q53GS9
RecName: U4/U6.U5 tri-snRNP-associated protein 2
Begin-End: 123-186
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEII
DSSL
Structures of the domain Q53GS9 123-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 V 124-185 None


© NPIDB team 2003 - 2019

text