Pfam domain
Pfam family: cNMP_binding (PF00027.28)
Uniprot AC: Q53W63
RecName: Transcriptional regulator LdrP
Begin-End: 1-90
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
MKRFARKETIYLRGEEARTLYRLEEGLVRVVELLPDGRLITLRHVLPGDYFGEEALEGKA
YRYTAEAMTEAVVQGLEPRAMDHEALHRVA
Structures of the domain Q53W63 1-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5i2d X-ray 4.41 G 2-76 None
5i2d X-ray 4.41 H 2-76 None
5i2d X-ray 4.41 S 2-76 None
5i2d X-ray 4.41 R 2-76 None


© NPIDB team 2003 - 2020

text