Pfam domain
Pfam family: HTH_Crp_2 (PF13545.5)
Uniprot AC: Q53W63
RecName: Transcriptional regulator LdrP
Begin-End: 114-187
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
ARIARYLLFLADTPLSARDRQGIYVTVSHEEIADATASIRESVSKVLADLRREGLIATAY
RRVYLLDLAALERE
Structures of the domain Q53W63 114-187
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5i2d X-ray 4.41 G 114-186 None
5i2d X-ray 4.41 H 114-186 None
5i2d X-ray 4.41 S 114-186 None
5i2d X-ray 4.41 R 114-186 None


© NPIDB team 2003 - 2020

text