Pfam domain
Pfam family: Ribosomal_L14 (PF00238.18)
Uniprot AC: Q54G86
RecName: 60S ribosomal protein L23
Begin-End: 17-136
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
LPVGAVMNSADNSGAKNLYVIAVKGIKGRLNRLPSAGVGDMVMATVKKGKPELRKKVCTG
LVVRQRKHWKRKDGVYIYFEDNAGVMCNPKGEVKGNILGPVAKECSDLWPKVATNAGTIV
Structures of the domain Q54G86 17-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 E 19-136 None
5anc X-ray 4.2 E 19-136 None
5an9 X-ray 3.3 E 19-136 None


© NPIDB team 2003 - 2019

text