Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: Q54J50
RecName: 60S ribosomal protein L12
Begin-End: 3-69
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
PKVDPSEKVEVFLRVCGGEAGAMSTLAPKLGPLGVSPKKVGDDIAKATQPWKGMKVSVKL
TIQNRIA
Structures of the domain Q54J50 3-69
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 D 14-67 None
5anc X-ray 4.2 D 14-67 None
5an9 X-ray 3.3 D 14-67 None


© NPIDB team 2003 - 2019

text