Pfam domain
Pfam family: Ribosomal_L16 (PF00252.17)
Uniprot AC: Q54J69
RecName: 60S ribosomal protein L10
Begin-End: 12-166
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
CKNKPYIKSRYCRGVPDAKIRIFDLGRKKASTDEFPLCVHLISLEKEQLSSEAIEAGRIS
CNKYISKTGGKDSFHMRVRVHPWHVLRINKMLSCAGADRLQTGMRGAFGKPMGTVARVNI
GQIIFSIRTRDNMLANVVEALRRSSYKFPGRQKIV
Structures of the domain Q54J69 12-166
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 F 12-166 None
5anc X-ray 4.2 F 12-166 None
5an9 X-ray 3.3 F 12-166 None


© NPIDB team 2003 - 2019

text