Pfam domain
Pfam family: Ribosomal_L24e (PF01246.19)
Uniprot AC: Q54VN6
RecName: 60S ribosomal protein L24
Begin-End: 1-66
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
MKTSLCNYSEFKIYPARGMKFVRGDSKVFHFINTKVESLFFRKINPRDIRWSMVYRRIYK
NTTTDV
Structures of the domain Q54VN6 1-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 G 1-64 None
5anc X-ray 4.2 G 1-64 None
5an9 X-ray 3.3 G 1-64 None


© NPIDB team 2003 - 2019

text