Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: Q54XI5
RecName: 60S ribosomal protein L9
Begin-End: 97-176
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
FPINVAVTDGGRVVEIRNFFGEKIVRRIELLDGITCYRNEKAKDEIVLTGNSLELLSQSC
ATIQLRSAIKYKDVRKFLDG
Structures of the domain Q54XI5 97-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 B 97-176 None
5anc X-ray 4.2 B 97-176 None
5an9 X-ray 3.3 B 97-176 None


© NPIDB team 2003 - 2019

text