Pfam domain
Pfam family: eIF-6 (PF01912.17)
Uniprot AC: Q551M2
RecName: Eukaryotic translation initiation factor 6
Begin-End: 4-204
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
RLQYENSCDVGVFLKLTNKYCLVGQCGSKQFLHTVENRLADHIPVVETSIAGTRIVGRLS
AGNKNGLLLPNTCTDQELQQIRNSLPDDVVVQRIEEKFSALGNCIATNDYVALVHPDIDR
ETEEIIADVLGVEVFRQTVSGNVLVGTYCALTNQGALVHPMTSIADQDELSSLLQVPLVA
GTVNRGNECVAAGCVVNDWTA
Structures of the domain Q551M2 4-204
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 I 4-203 None
5an9 X-ray 3.3 I 4-203 None


© NPIDB team 2003 - 2019

text