Pfam domain
Pfam family: MutS_IV (PF05190.17)
Uniprot AC: Q56215
RecName: DNA mismatch repair protein MutS
Begin-End: 403-494
Organism: Thermus aquaticus
Interaction Mode:  S-Bb L-Bb 

Sequence:
GYDPDLDALRAAHREGVAYFLELEERERERTGIPTLKVGYNAVFGYYLEVTRPYYERVPK
EYRPVQTLKDRQRYTLPEMKEKEREVYRLEAL
Structures of the domain Q56215 403-494
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nne X-ray 3.11 B 1403-1492  S-Bb L-Bb 
1nne X-ray 3.11 A 403-492  S-Bb L-Bb 
1fw6 X-ray 2.7 B 1403-1490  S-Bb 
1fw6 X-ray 2.7 A 403-490 None
1ewq X-ray 2.2 B 1403-1490  S-Bb 
1ewq X-ray 2.2 A 403-490 None


© NPIDB team 2003 - 2020

text