Pfam domain
Pfam family: MutS_V (PF00488.23)
Uniprot AC: Q56215
RecName: DNA mismatch repair protein MutS
Begin-End: 579-762
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
VLITGPNMAGKSTFLRQTALIALLAQVGSFVPAEEAHLPLFDGIYTRIGASDDLAGGKST
FMVEMEEVALILKEATENSLVLLDEVGRGTSSLDGVAIATAVAEALHERRAYTLFATHYF
ELTALGLPRLKNLHVAAREEAGGLVFYHQVLPGPASKSYGVEVAAMAGLPKEVVARARAL
LQAM
Structures of the domain Q56215 579-762
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nne X-ray 3.11 B 1579-1763 None
1nne X-ray 3.11 A 579-763 None
1fw6 X-ray 2.7 A 579-763 None
1fw6 X-ray 2.7 B 1579-1761 None
1ewq X-ray 2.2 B 1579-1761 None
1ewq X-ray 2.2 A 579-763 None


© NPIDB team 2003 - 2021

text